SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010869 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010869
Domain Number 1 Region: 13-40,89-163
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-24
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000119
Family Voltage-gated potassium channels 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010869   Gene: ENSCJAG00000005908   Transcript: ENSCJAT00000011479
Sequence length 323
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:40368200:40376147:-1 gene:ENSCJAG00000005908 transcript:ENSCJAT00000011479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAWLCSCWGGRVLPLLLAYVCYLLLGATIFQLLEKQAEAQSRNEFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNNLGTGLRAHLATIERWEDQPRRSQLLRVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFGEGFYFAFITLSTIGFGDYVVGHPLNFIPPFGLLPSQGPLQ
IPPGKPESQQRPESFQKVSSMNIWPLSGMHPPGLAFPLPDCNVPDQKERFRPIHPEAWKL
WPLPFPLPNSKWAPTWLGSSAQD
Download sequence
Identical sequences F7HTD8
XP_017826550.1.60252 ENSCJAP00000010869 ENSCJAP00000010869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]