SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011126 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011126
Domain Number 1 Region: 249-587
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.87e-104
Family PDEase 0.00000167
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000011126
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00159
Family Heme-binding PAS domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011126   Gene: ENSCJAG00000006029   Transcript: ENSCJAT00000011744
Sequence length 593
Comment pep:novel chromosome:C_jacchus3.2.1:6:13207056:13227382:-1 gene:ENSCJAG00000006029 transcript:ENSCJAT00000011744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQYANPAVEATMGYQSGELLGKELREVCINEKTADLLDTKNSWGETGWRHGPSLPTLRK
RGENEGKNNPIPSPGSSGGHMKGAGVMAVPETEGIAVVLMQCIHGKQHCCGHVERLFKGK
FPKSYDTQTASSKKIWVSNQRQQHSSMARTHFMTIEASITKAISMINTVRESSPMVVTEA
LDRVLEILRTTELYSRRLRVKDDDPHASDLVEGLMSDGLQRPSGNEYVPSTKNIQMVSGT
VTPISLDDVPPRIAQAVANVESWDFDIFELEAATHNRPLIYLGLHIFVRFEICEFLRCSE
STLSSWLGIIEANYHSSNPYHNSTHAADVLHATAYFLSKERITETFDQFDKVAALIAATI
HDVDHPGRTNSFLCNSGSQLAILYNDTSVLESHHAALAFQLSLGDDKYNIFKNMDRNDYR
TLRQGIIDMVLATEMTNHSEHVSEFVNSINTPLATLEENGDADNREEIIHDFLRIPVNRT
LIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQKNLAVTLPVFDRKTCSIP
SCQVFFIEFIKPMFDAWNAFVDLPNLIRHLEHNLQYWNGLNTQGHQNLLWPPS
Download sequence
Identical sequences F7I486
ENSCJAP00000011126 ENSCJAP00000011126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]