SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011149 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011149
Domain Number 1 Region: 4-479
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-155
Family ALDH-like 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011149   Gene: ENSCJAG00000006063   Transcript: ENSCJAT00000011767
Sequence length 481
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:3899599:3938365:-1 gene:ENSCJAG00000006063 transcript:ENSCJAT00000011767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLPDAKTIPVKDPDNGASLGMMNDCGVPEEHAAVRAAYEAFCSWKRDSAKERSSLLRKWY
DLMIKNKDDLAKIITAESGKPLKEAQGEILYSALFLEWFSEEARRVYGDIIYTSARDKRS
LVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAEILYAFV
VYRDIILLLANQAGIPPGVYNVIPCSRKNAKEVGEVICTDPLVSKISFTGSTTTGKVLLH
HAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNRFLVQRGIHD
AFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVCKGATIVTGGKRHQ
LGKNFFEPTLLSNVTQDMLCSHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQD
PAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGG
L
Download sequence
Identical sequences F7I451
ENSCJAP00000011149 ENSCJAP00000011149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]