SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011191 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011191
Domain Number 1 Region: 44-238
Classification Level Classification E-value
Superfamily E set domains 3.5e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000514
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000204
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011191   Gene: ENSCJAG00000006092   Transcript: ENSCJAT00000011810
Sequence length 290
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:13653315:13656868:1 gene:ENSCJAG00000006092 transcript:ENSCJAT00000011810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKIS
QPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIP
LHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEA
TGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFRDLEVPTPSCSARELAEAAA
RLDAHLYWSIPSRLYDKVEEEGAGDGAFFYFFLTQVHGHCILEVEEERRV
Download sequence
Identical sequences F7HX41
ENSCJAP00000011191 ENSCJAP00000011191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]