SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011203 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000011203
Domain Number - Region: 219-250
Classification Level Classification E-value
Superfamily Kringle-like 0.0824
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011203   Gene: ENSCJAG00000006068   Transcript: ENSCJAT00000011823
Sequence length 406
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:53769179:53826189:1 gene:ENSCJAG00000006068 transcript:ENSCJAT00000011823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQAGFPLGILLLLWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIAMISYNIIAGDTLSKVFQRIPGVDPENLFIGRHFIIGLSTVTFTLPLSLYRDIAK
LGKVSLISTGLTTLILGIVMARAVSLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHN
SFLVYSSLEEPTVAKWSRLIRMSIVISVFICIVFATCGYLTFTGFTQGDLFENYCRNDDL
VTFGRFCYGITVILTYPMECFVTREVIANVFFGGNLSLVFHIVVTVIVITVATLVSLLID
CLGIVLELNGVLCATPLIFIIPSACYLKLSEEPKTHSDKIMSCVMLPIGAVVMVFGFVMA
VTNPQDCTHGQEMFYCFPDNFSLTNTSDSHVQQTTQLSILNISLFQ
Download sequence
Identical sequences F7ISR0
ENSCJAP00000011194 ENSCJAP00000011203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]