SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011693 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011693
Domain Number 1 Region: 134-278,368-437
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011693   Gene: ENSCJAG00000006141   Transcript: ENSCJAT00000012335
Sequence length 562
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:53399387:53472964:-1 gene:ENSCJAG00000006141 transcript:ENSCJAT00000012335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILFVFLDDITLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIL
ARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLK
TIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSF
FNNSLDGNGTTFNRTVSMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVK
AGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFY
LINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFS
GAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKSDRVRKSESEDSIRKK
GFRFSLEGSRLTYEKRFSSPHQ
Download sequence
Identical sequences F7H2P1
ENSCJAP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]