SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011705 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011705
Domain Number 1 Region: 1210-1365,1404-1483
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1533-1730,1758-1783
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-39
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 761-908,942-989
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 131-276,365-434
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000011705
Domain Number - Region: 1792-1837
Classification Level Classification E-value
Superfamily EF-hand 0.012
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011705   Gene: ENSCJAG00000006343   Transcript: ENSCJAT00000012348
Sequence length 2002
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:52660068:52735543:1 gene:ENSCJAG00000006343 transcript:ENSCJAT00000012348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI
AIKILVHSYPFSIFSMLIMCTILTNCVFMTMSSPPDWTKNVEYTFTGIYTFESLIKIIAR
GFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQWPPTNASLEEHSIEKNI
TVNYNGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLCGNSSDAGQCPEGYICVKAGR
NPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLIN
LILAVVAMAYEEQNQATLEEAEQKEAEFQQMIEQLKKQQEAAQQAVTATASEHSREPSAA
GRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFHKSESEDSIRRKGFRF
SIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHS
TFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGG
PSVPTSPVGQLLPEGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEEL
EESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAM
EHYPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVEL
GLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAM
CLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMQKGVAYVK
RKIYEFIQQSFVRKQKILDEIKPLDDLNNKKDSCMSNHTTEIGKDLDYLKDVNGTTSGIG
TGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNE
SSSSSEGSTVDIGAPAEEQPVVEPEETLEPEACFTEGCVQRFKCCQINVEEGRGKQWWNL
RRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEM
LLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRAL
SRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTGDRFDV
EEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAAVDSRNV
ELQPQYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKY
YNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSE
YVTTILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEK
YFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIF
GMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKAN
PGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEM
FYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDI
LFAFTKRVLGESGEMDALRIQMEERFMASNPSKASYQPITTTLKRKQEEVSAVIIQRAYR
RHLLKRTVKQASFTYNKNKIKGGANLLIKEDMIIDRINENSITEKTDLTMSTAVCPPSYD
RVTKPIVEKHEQEGKDEKAKGK
Download sequence
Identical sequences F7GM75
ENSCJAP00000011705 ENSCJAP00000011705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]