SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011719 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011719
Domain Number 1 Region: 617-753
Classification Level Classification E-value
Superfamily EF-hand 0.00000000158
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 447-500,537-661
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000165
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011719   Gene: ENSCJAG00000006321   Transcript: ENSCJAT00000012362
Sequence length 943
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:105984899:106057669:-1 gene:ENSCJAG00000006321 transcript:ENSCJAT00000012362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSRRVQPQQPGDAKQLMAGGAAVGASLAARGGLREQRGLEIEMQRIRQAAARDPPAGA
SASPSPPLSSCSRQAWSRDNPGFEVVVEMDVEWRPGSRRSAASSAVSSAGARSRGLGGYH
GAGHPSGRRHRREDQGPPCPSPTGGGDPLHRHLPLDGQPPRVAWAVRLVRGLRGLWGTRL
MEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKT
EKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLR
VRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIAT
YSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEF
PATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFILYYLVEEILEIRIHKLHYFRS
FWNCLDVLIIVLSVVAIGINIYRTSNVDVLLQFLEDQNTFPNFEHLAYWQIQFNNVAAVI
VFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDD
FSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYS
EVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTADDISESLRQGGGKLNFDELRQDL
KGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSF
PRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIV
KLEIMERAKLKRREVLGRLLDGVAEDERLGRDGEIHREQMERLVREELERWESDDAASQI
SHGLGTPVGLNGQPCPRSSRPSSSQSTEGMEGAGGNGNSNVHI
Download sequence
Identical sequences F7GM51
ENSCJAP00000011719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]