SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011949 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011949
Domain Number 1 Region: 243-347
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-30
Family Pleckstrin-homology domain (PH domain) 0.0000029
Further Details:      
 
Domain Number 2 Region: 117-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.12e-25
Family DEP domain 0.00000311
Further Details:      
 
Domain Number 3 Region: 11-110
Classification Level Classification E-value
Superfamily PH domain-like 6.94e-21
Family Pleckstrin-homology domain (PH domain) 0.00000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011949   Gene: ENSCJAG00000006477   Transcript: ENSCJAT00000012602
Sequence length 350
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:38559749:38579458:-1 gene:ENSCJAG00000006477 transcript:ENSCJAT00000012602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEQRRCHKTFLKPTGSMFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETFDLGNLIIAFKNNERDIADLDLEVYKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMI
ASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFLCEENSSDDDVIMKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAIHLRGCVVTSV
ESNSDGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQVASRTGK
Download sequence
Identical sequences F7GBC9
ENSCJAP00000011949 ENSCJAP00000011949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]