SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012080 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012080
Domain Number 1 Region: 237-479
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.12e-55
Family Decarboxylase 0.000000516
Further Details:      
 
Domain Number 2 Region: 15-201
Classification Level Classification E-value
Superfamily PRTase-like 8.66e-44
Family Phosphoribosyltransferases (PRTases) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012080   Gene: ENSCJAG00000006554   Transcript: ENSCJAT00000012741
Sequence length 481
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:72184541:72259307:-1 gene:ENSCJAG00000006554 transcript:ENSCJAT00000012741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGVALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLAAVICSTNEIPMLIRRKETKDYGTKRLVEGAINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKIDTEMAGRVKRFIKENVFVAANQNGSPFSVKETPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKRYEFLIFEDRKFADIGNTVKKQYEGRGIFKIASWADLVNAHVVPGSGVVKGLQEVGL
PLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGV
QLEARGDNLGQQYNNPQEVIGKRGSDIIIVGRGIISAANRLEAAEMYRKAAWEAYLSRLG
V
Download sequence
Identical sequences F7GN90
ENSCJAP00000012080 ENSCJAP00000012080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]