SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012135 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012135
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.65e-42
Family Decarboxylase 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012135   Gene: ENSCJAG00000006554   Transcript: ENSCJAT00000012797
Sequence length 252
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:72184678:72259244:-1 gene:ENSCJAG00000006554 transcript:ENSCJAT00000012797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEILEQQKKIDTEMAGRVKRFIKENVFVAANQNGSPFSVKETPKELSFGARAELPRIHP
VASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKEL
ITLAKRYEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVG
LPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPG
VQLEARGDNLGQ
Download sequence
Identical sequences F7EIU7
ENSCJAP00000012135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]