SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012156 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012156
Domain Number 1 Region: 7-236
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.59e-65
Family Proteasome subunits 0.00000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012156   Gene: ENSCJAG00000006541   Transcript: ENSCJAT00000012820
Sequence length 277
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:168176274:168237870:-1 gene:ENSCJAG00000006541 transcript:ENSCJAT00000012820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSVYAPLVGGFSFDNCRRNAVLEADFAKKGYKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFKPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYTVPNKKGT
RFGRYRCEKGTTAVLTEKVTTLEIEVLEETVQTMDTS
Download sequence
Identical sequences F7DRQ0
ENSCJAP00000012156 ENSCJAP00000012156 XP_002743351.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]