SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012159 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012159
Domain Number 1 Region: 358-486
Classification Level Classification E-value
Superfamily Plus3-like 2.75e-46
Family Plus3 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012159   Gene: ENSCJAG00000020746   Transcript: ENSCJAT00000012823
Sequence length 712
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:34425288:34498135:-1 gene:ENSCJAG00000020746 transcript:ENSCJAT00000012823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRLCVGRAAAVAAAAAVAVPLAGGQEGSPGGVRRGSRGTTMVKKRKGRVVIDSDTEDS
GSDENLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNKNKKKGKAR
KIEKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEF
HDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKE
KKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAE
LLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEE
LNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLG
GTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELS
IKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQ
LNELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDPFTRRQ
CKPTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDL
FKVHDFDVKIDLQVPSSESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences F7DRN1
XP_002753567.3.60252 ENSCJAP00000012159 ENSCJAP00000012159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]