SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012164 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012164
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.18e-71
Family Alanine racemase-like, N-terminal domain 0.000000000766
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.55e-49
Family Eukaryotic ODC-like 0.000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012164   Gene: ENSCJAG00000006576   Transcript: ENSCJAT00000012828
Sequence length 461
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:98131851:98140039:1 gene:ENSCJAG00000006576 transcript:ENSCJAT00000012828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVMPFYAVKCNDSRAIVNALAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAICRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQAITDARCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSEVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQI
QNPDFPPEVEEQDVSTLPVSCAWESGMERHPAACASASINV
Download sequence
Identical sequences F7GMF7
XP_002758083.1.60252 XP_008979384.1.60252 XP_008979386.1.60252 ENSCJAP00000012164 ENSCJAP00000050811 ENSCJAP00000012164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]