SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012194 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012194
Domain Number 1 Region: 223-340
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 6.02e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 100-229
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 5.49e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000034
Further Details:      
 
Domain Number 3 Region: 47-98
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000108
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012194   Gene: ENSCJAG00000006600   Transcript: ENSCJAT00000012861
Sequence length 347
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:46613327:46626356:1 gene:ENSCJAG00000006600 transcript:ENSCJAT00000012861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMLRSLRVFLLVARTGSHPAGSLLRQSPQPPHTFHAGPCLSASASSKELLMKLRRKTGY
SFVNCKKALETCGEDLKQAEIWLHKQAQKEGWSKAAKLQGRKTKEGLIGLLQEGNITVLV
EVNCETDFVSRNLKFQQLVQQVALGTMMHCQNLKDQLSTYSKVTWWLMPVNLALWEVETG
SLEGFLNSSELSRLPAGPDREGSLKDHLALAIGKLGENMTLKRAAWVKVPSGFYVGSYVH
GVMQSPSLHNLVLGKYGALVICETSEQNANLEDIGRRLGQHVVGMAPLSVGSLDDEPGGE
AETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE
Download sequence
Identical sequences F7HE72
ENSCJAP00000047022 ENSCJAP00000012194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]