SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012220 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012220
Domain Number 1 Region: 91-135
Classification Level Classification E-value
Superfamily LysM domain 0.0000000103
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012220   Gene: ENSCJAG00000006571   Transcript: ENSCJAT00000012888
Sequence length 840
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:87869951:87970040:-1 gene:ENSCJAG00000006571 transcript:ENSCJAT00000012888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLTTFTGKSGRLLRGTANRLWGFTGGGEARQVRFEDYLREPAQGDPGCGSPPHRPPAP
SSPEGPDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNK
LFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKTTNPDVHPKETTPS
STLTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCHSKKMTGSN
TQEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQDKSSGASS
ESVQTVNQTEVESLTVKSELTSTPGHLRSDTEHSTNEVGTLSHKTDLNNLEMAIKQGDQV
ADNFQGVSGPKEDSLSIKGNSDQDSFLHENSLHQVENKKENMPCGETTGFKQKQTLNKGK
QGKVQNQNSETEVEELRKLWKTHTMQQTKQQRENIQQVSQKEVKHKITSADGHIESPAFL
KEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFF
IQWSPEIYAEDTGEYTREPGFIVVKKIEESETVEDSSNQAAAREWEITTREDINSKQVAP
VKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYR
TMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNM
FFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences F7GT92
ENSCJAP00000012220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]