SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012237 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012237
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000000105
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012237   Gene: ENSCJAG00000006571   Transcript: ENSCJAT00000012905
Sequence length 847
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:87869951:88368636:-1 gene:ENSCJAG00000006571 transcript:ENSCJAT00000012905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSNISWLKKKSQSVDINAPGFNPLAGAGKQSPQASKPPAPKAPIIEEEQNNAANTQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKTTNPDVH
PKETTPSSTLTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIM
FDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCHS
KKMTGSNTQEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQD
KSSGASSESVQTVNQTEVESLTVKSELTSTPGHLRSDTEHSTNEVGTLSHKTDLNNLEMA
IKQGDQVADNFQGVSGPKEDSLSIKGNSDQDSFLHENSLHQVENKKENMPCGETTGFKQK
QTLNKGKQGKVQNQNSETEVEELRKLWKTHTMQQTKQQRENIQQVSQKEVKHKITSADGH
IESPAFLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERT
DHLYAFFIQWSPEIYAEDTGEYTREPGFIVVKKIEESETVEDSSNQAAAREWEITTREDI
NSKQVAPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGT
SLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVF
KWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQD
IEIWAFE
Download sequence
Identical sequences F7GN44
ENSCJAP00000012237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]