SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012486 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012486
Domain Number 1 Region: 361-471,582-730
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.65e-51
Family Phosphate binding protein-like 0.0000118
Further Details:      
 
Domain Number 2 Region: 1-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.06e-24
Family L-arabinose binding protein-like 0.007
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000012486
Domain Number - Region: 489-575
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00659
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012486   Gene: ENSCJAG00000006737   Transcript: ENSCJAT00000013162
Sequence length 926
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:100117517:100831323:-1 gene:ENSCJAG00000006737 transcript:ENSCJAT00000013162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDD
YTLSVRPPVYLNDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVE
NNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIII
NEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNME
ISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVNGL
TGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGV
VLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQE
DGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFAC
LAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGG
EVPYTTLAARMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTEIPYGT
VLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVW
DAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPYRDVFSQRILELQQNGDMDLLK
HKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAAGVVLSCFIAMLETWWNKRKGS
RVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISD
FRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKT
MSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences F7E4U9
ENSCJAP00000012486 ENSCJAP00000012486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]