SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012658 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012658
Domain Number 1 Region: 364-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.85e-81
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 196-302
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.00047
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 3.01e-19
Family Fibronectin type II module 0.0057
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012658   Gene: ENSCJAG00000006834   Transcript: ENSCJAT00000013338
Sequence length 612
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:61761619:61769989:1 gene:ENSCJAG00000006834 transcript:ENSCJAT00000013338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGFLLVSLESTLSIPPWKSPKEHKNKDKEHTVVLTVNGEPCHFPFQYHRQLYHK
CIHKDRPGPQPWCATTPNFDQDQQWAYCLEPKKLSDHCSKHSPCQKQGTCVNTPRGPHCL
CPQHLTGNHCQREKCFEPQLLRFFHQNEIWYRSEQAGVARCRCKGPDAHCQQLASQACRD
NPCLHGGRCLEAEGHRLCHCLVGYTGPFCDVDTKASCYDGRGLSYRGLARTTLSGMPCQP
WASEATYRNVTAEQARNWGLSGHAFCRNPDNDVRPWCFVLSGDRLSWEYCDLAQCQAPPT
RMPPRFNESSMPTQLTLPKPQPTSRTPPLSQTPGASPTRRKQPPPLTRNGSLSCGQRLRK
RLSSLRRIVGGLVALPGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQNRPAPEELTV
VLGQDRHNHSCEQCQTLAVRSYRLHEAFSPVNYQHDLALLRLQEDADGSCALLSPYVQPV
CLPSSATRPSQPEPAVCEVAGWGHQFEGAEEYSSFLQEAQVPFLSLERCSAPDVHGASIL
PGMLCAGFLEGGTDACQGDSGGPLVCEDQAAGRRLTLRGVVSWGSGCGDRNKPGVYTDVA
NYLSWIQEHTAS
Download sequence
Identical sequences F6PYR3
ENSCJAP00000012658 ENSCJAP00000012658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]