SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012739 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012739
Domain Number 1 Region: 13-532
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.28e-48
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 492-642
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000136
Family WD40-repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012739   Gene: ENSCJAG00000006842   Transcript: ENSCJAT00000013422
Sequence length 643
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:125749689:125804594:1 gene:ENSCJAG00000006842 transcript:ENSCJAT00000013422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKMFLRGRPITMYMPKDQVDSYNLEAKVELPTKRLKLEWHPQSYGYRGRDCRNNLYLLPT
GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPP
HVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEK
LADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLC
VTFSENGDTITGDSSGNILVWGKDHSESMRPVKGTNRISYAVQGAHEGGIFALCMLRDGT
LVSGGGKDRKLISWSGNYQRLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSG
DFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFH
PSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIY
GVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYSGVPSACKQVVSVET
TRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQ
FRAPSHIYGGHSSHVTNVNFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences F6S2W2
ENSCJAP00000012739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]