SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012817 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012817
Domain Number 1 Region: 422-911
Classification Level Classification E-value
Superfamily ALDH-like 5.89e-165
Family ALDH-like 0.00000000071
Further Details:      
 
Domain Number 2 Region: 11-211
Classification Level Classification E-value
Superfamily Formyltransferase 8.63e-51
Family Formyltransferase 0.00000000255
Further Details:      
 
Domain Number 3 Region: 215-316
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.24e-26
Family Post formyltransferase domain 0.00000106
Further Details:      
 
Domain Number 4 Region: 333-416
Classification Level Classification E-value
Superfamily ACP-like 0.00000806
Family Acyl-carrier protein (ACP) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012817   Gene: ENSCJAG00000006865   Transcript: ENSCJAT00000013509
Sequence length 912
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:70989979:71075220:1 gene:ENSCJAG00000006865 transcript:ENSCJAT00000013509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGPSNHPTAMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLQAEKDG
VPVFKFARWRAKGQVLPDVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLL
PRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFP
EGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKV
PGAWTEACEQKLTFFNSTLNTSGLVPEGDTLPIPGAHRPGVVTKAGLILFGNDDRMLLVK
NIQLEDGKMIPASNFFKGEGSSALELTEVELAIAEAVRSAWQRILPNVLEVEDSTDFFKS
GAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGEYSIDYVE
MAVNKRTLHMPHQLFIGGAFIDAEGAKTFETINPTDGSVICQVSLPQVTDVDKAVAAAKD
AFENGLWGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTF
RYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAA
GNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTG
STEVGKHIMKSCAVSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAA
GRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLMKLIEYCQRGVKEGA
TLICGGKQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFTDGDIDAVLSRANAT
EFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALN
EYLRVKTVTFEY
Download sequence
Identical sequences F6PXK1
ENSCJAP00000012817 ENSCJAP00000012817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]