SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012837 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012837
Domain Number 1 Region: 37-216
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.17e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012837   Gene: ENSCJAG00000006929   Transcript: ENSCJAT00000013529
Sequence length 265
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:7636836:7648760:-1 gene:ENSCJAG00000006929 transcript:ENSCJAT00000013529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LADASKLPNLKELLQSSGDNHKWAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTP
VPAPDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFG
EGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKELDRR
RARIKHSEGGDIPPKYFVVTNNQLLRVKFLLVYSQKPPKSRASSQLSWFSSHWFTVMISL
YLLLLLIVSVINSSAFQHFWNRVKR
Download sequence
Identical sequences F6PMS2
ENSCJAP00000012837 ENSCJAP00000012837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]