SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012840 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012840
Domain Number 1 Region: 311-800
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-165
Family ALDH-like 0.00000000071
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Formyltransferase 7.06e-27
Family Formyltransferase 0.000000381
Further Details:      
 
Domain Number 3 Region: 113-205
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.16e-19
Family Post formyltransferase domain 0.00000296
Further Details:      
 
Domain Number 4 Region: 222-305
Classification Level Classification E-value
Superfamily ACP-like 0.00000677
Family Acyl-carrier protein (ACP) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012840   Gene: ENSCJAG00000006865   Transcript: ENSCJAT00000013533
Sequence length 801
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:70990630:71075215:1 gene:ENSCJAG00000006865 transcript:ENSCJAT00000013533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLQAEKDGVPVFKFARWR
AKGQVLPDVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGASAIH
NWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDTLPIPGAHRPGVVTKAGLILFG
NDDRMLLVKNIQLEDGKMIPASNFFKGEGSSALELTEVELAIAEAVRSAWQRILPNVLEV
EDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEE
GEYSIDYVEMAVNKRTLHMPHQLFIGGAFIDAEGAKTFETINPTDGSVICQVSLPQVTDV
DKAVAAAKDAFENGLWGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKT
HVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLS
WKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHP
DVRKIGFTGSTEVGKHIMKSCAVSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFF
NKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLMKLIEY
CQRGVKEGATLICGGKQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFTDGDID
AVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFG
KDLGEAALNEYLRVKTVTFEY
Download sequence
Identical sequences F6PMB9
ENSCJAP00000012840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]