SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012908 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012908
Domain Number 1 Region: 92-249
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.18e-31
Family Glutamine synthetase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 12-80
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00000000106
Family Glutamine synthetase, N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012908   Gene: ENSCJAG00000006968   Transcript: ENSCJAT00000013602
Sequence length 251
Comment pep:novel chromosome:C_jacchus3.2.1:18:4861791:4863870:-1 gene:ENSCJAG00000006968 transcript:ENSCJAT00000013602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWALNNGTGEGLCCRTQTLDREPKCVEKWPEWNSDTSSTLLSEGSDSDMYLVPAAMFQDP
FRKDPNKLVCEVFKYDRKPAETNLRHTCMVSNQHPWFGMEQEYALMGTDGHAFGWPSNSF
PGPQGPYYCNVGADRAYGRNIVEAHYWACLYAGVKIQAGTNTKVMCAQWFPLCEGISMGD
HLWVAHFILHRVCEDSVMAIFDPKPIPRNWNGSGCHTNFSTKATWEENCLKYIEEAIEKL
SKWHQYHIHTY
Download sequence
Identical sequences F6S249
ENSCJAP00000012908 ENSCJAP00000012908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]