SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013073 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013073
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily UBC-like 1.15e-42
Family UEV domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 322-382
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.73e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000013073
Domain Number - Region: 235-311
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0408
Family FCH domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013073   Gene: ENSCJAG00000007032   Transcript: ENSCJAT00000013782
Sequence length 389
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:82018048:82051513:-1 gene:ENSCJAG00000007032 transcript:ENSCJAT00000013782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPISTSYPPYQATGPPNTSYMPGMPGGISSYPSGYPP
NPRLVYCWNFKVLSVHIALFSEGSLSLLLFPAGPSRDGTISEDTIRASLISAVSDKLRWR
MKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSA
LEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLK
HVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences F6ZIZ6
ENSCJAP00000013073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]