SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013151 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013151
Domain Number 1 Region: 80-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000122
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013151   Gene: ENSCJAG00000007092   Transcript: ENSCJAT00000013862
Sequence length 367
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:17619836:17621983:-1 gene:ENSCJAG00000007092 transcript:ENSCJAT00000013862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTPPPQSLLSRDHWIFAQGWGWAGHSDSTSPASSSDSSGSCPCDGARGLPQPAVLDRG
SQAAEAAPTTPRRARSGPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVVPAGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQRRRLQRGEAGSSRGCPLCPDGGPAQAQTQTQRG
GRVVRSWASWGSSPACPGARAAPERLGSGVHDADPWATPPYCPKIQSPPYSSQGTTSDAS
LWTPPQSCPWTQPSPEPRNPPAPWTTPPATLELATVYQGLSVSPESCLSLGTPSLLPHPS
CQRLQPQTPWGCWSHSTEVLPTSEDQGQGAAFQLSEASPPQSSALRFSGCPELWQEDLEG
ARVSIFY
Download sequence
Identical sequences F6UCU6
ENSCJAP00000013151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]