SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013254 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013254
Domain Number 1 Region: 192-256
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.48e-20
Family RILP dimerisation region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013254   Gene: ENSCJAG00000007134   Transcript: ENSCJAT00000013966
Sequence length 300
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:114391217:114440498:-1 gene:ENSCJAG00000007134 transcript:ENSCJAT00000013966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDINFSEEEFQKHEGMSERERQV
MKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKAL
IEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHGQNGEEPETEPVGEESISDAEKVA
MDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPAPIAHP
RTSPQPESGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANMHRDDGYTEQGQEALQHL
Download sequence
Identical sequences F6XXE0
ENSCJAP00000013254 ENSCJAP00000013254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]