SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013323 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000013323
Domain Number - Region: 98-130
Classification Level Classification E-value
Superfamily HAD-like 0.0259
Family NagD-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013323   Gene: ENSCJAG00000007169   Transcript: ENSCJAT00000014037
Sequence length 161
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:114491180:114495923:1 gene:ENSCJAG00000007169 transcript:ENSCJAT00000014037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLNPHKPITPEHSTFITSSSLKDRIHCVAYVLDINSIDNLSSEMLAKFKKVRKEILSCGI
AHAALLTNVSDCSEVLQDNFLNMSRSMTSQSQVANVNKMLGIPISNILMVGNYASDLELN
PMNNILILSAQRQLLQAADAFLEDLPLEETDTIVRVLQPRI
Download sequence
Identical sequences F7C0C8
ENSCJAP00000013323 XP_017829488.1.60252 ENSCJAP00000013323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]