SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013379 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013379
Domain Number 1 Region: 4-487
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-122
Family ALDH-like 0.000000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013379   Gene: ENSCJAG00000007183   Transcript: ENSCJAT00000014095
Sequence length 503
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:52866219:52885924:-1 gene:ENSCJAG00000007183 transcript:ENSCJAT00000014095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKGLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADLLSGRHRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVEL
EGEQPLSVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFHTFPRLTGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPQSL
WPQIKRRLLEEHGRIKVGDPAEDFGTFFSAVIDAKSFGRIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLTVYVYPDDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLGDWGYAYMQ
Download sequence
Identical sequences F7AGU5
ENSCJAP00000013379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]