SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013384 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013384
Domain Number 1 Region: 30-547
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-124
Family ALDH-like 0.000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013384   Gene: ENSCJAG00000007183   Transcript: ENSCJAT00000014101
Sequence length 563
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:52864960:52897799:-1 gene:ENSCJAG00000007183 transcript:ENSCJAT00000014101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAPALRRALLSRPWTRAGLQWKHISSLKVANEPILAFTKGSPERDALQKALKDLKGR
TEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKGLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADLLSGRHRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVEL
EGEQPLSVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFHTFPRLTGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPQSL
WPQIKRRLLEEHGRIKVGDPAEDFGTFFSAVIDAKSFGRIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLTVYVYPDDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLGDWGYAYMQ
Download sequence
Identical sequences F6ZZR3
ENSCJAP00000013379 ENSCJAP00000013384 XP_008998773.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]