SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013391 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000013391
Domain Number - Region: 838-878
Classification Level Classification E-value
Superfamily ARM repeat 0.00633
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 547-602,993-1063
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0204
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number - Region: 460-675,841-859
Classification Level Classification E-value
Superfamily ARM repeat 0.0978
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013391   Gene: ENSCJAG00000007180   Transcript: ENSCJAT00000014108
Sequence length 1079
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:7998317:8033226:1 gene:ENSCJAG00000007180 transcript:ENSCJAT00000014108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLIRMGPQERRLFRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWGAVSSHQPV
KLASRDLPSEEMMMASSDPPKPSSEMRGEMLVPQASVDSDEATLSITVGNIPNIPKRTAK
MISTTTKNNYSPTAAGTERRKENTPTFSRTLTYYTPTSSRQIVKKYTPTSRGEVKSYSPT
QASEKVKYTPSPRGRRVGTYAPSTFMTMETSMITPRTTVKDSDIMATYKILETNSLKRME
ETALTTLKGMVDSTPPYLTYEVETNVLTSPRNIVEKNNLTPPRRMENNSSTHPWGLVGKN
NLMTQGTVLTHTPATSEGQVTISTMTGSSPAETKASTAARSVRNPSPGTSVSAIETTPAT
VWRLAKKPSTAPSTSATPMVRAKLTTQVHHCVVVKPTPAMPTTLSPSLSTALLPEELSPS
PSVLPSSLPDLHPKGEYPPDLFSVEERRQGWVVLHIFGMMYVFVALAIVCDEYFVPALGV
ITDKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGTC
SLFSREILHLTWWPLFRDVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTMKWN
KQIEVWVKEQLSRRSAAKVMALGNLSKLPSLLTRGSSSTSLHNSTIRSTIYQLMLHSLDP
LREVRLAKEKEEESLNQEARAQPQAKAESKPEEEEPAKLPVVTVTSAPALDIKGDQKKNP
GGQEDVAEAESTGEEGETVGEGETKEKSGGETQPGGEGETEEKRGGETQPGSEGETEGEG
KGDNEGEGEGEICTEDSEMKGNEGKTESQKLRGENHGEAKNDEKDIEAEGGSDGGDSEEE
EKEEEEEEEEEEEEEEEEEEEQQEQEEEEEEENEEPLSLDWPETRQKQAIYLFLLPIVFP
LWLTVPDVRRPESRKFFVLTFLGSIVWIAMFSYLMVWWAHQVGETIGISEEIMGLTILAA
GTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPVPWLLFSLINGLQPVPVSSNG
LFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFVFLIISVMLEDRIISCPVSV
Download sequence
Identical sequences F6ZHJ3
ENSCJAP00000013389 ENSCJAP00000013391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]