SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013510 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013510
Domain Number 1 Region: 410-606
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-48
Family cAMP-binding domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 164-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-37
Family Voltage-gated potassium channels 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013510   Gene: ENSCJAG00000007236   Transcript: ENSCJAT00000014232
Sequence length 696
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:2497038:2515939:1 gene:ENSCJAG00000007236 transcript:ENSCJAT00000014232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRGLADSGQGSFTNQGLTSFRRIQKKSQPEKVLRKASCGRPLIGWTQWCAEGDEGESE
IALAGSHRCASEPRLSRLVFSLHRWASRHVPHQEQGPASFPDRFHGAELKEVSSQESNAQ
ATVDVQEAEDRGRRAWPLAKHNTNTSNNKEEEKKKEKKDGFVMDPSSNLYYRWLTAIALP
VFYNWCLLICRACFDELQSEYLMLWLVLDYSADVLYVLDMFVRARTGFLEQGLMVSDTDR
LWQHYKATMQFKLDVLSLVPTDLAYLQVGMNFPELRFNRLLKFARLFEFFDRTETRTNYP
NIFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYW
STLTLTTIGETPPPVKDAEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKID
SIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLK
KVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQF
VVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKAL
EEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGTSLDILQTRFARLLAEYNATQMKM
KQRLSQLESQMKGGGDSPLANGEVPGDTTKTEDKQQ
Download sequence
Identical sequences F6ZYA5
ENSCJAP00000013510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]