SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013546 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013546
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000275
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013546   Gene: ENSCJAG00000007263   Transcript: ENSCJAT00000014268
Sequence length 226
Comment pep:novel chromosome:C_jacchus3.2.1:18:5131766:5139529:-1 gene:ENSCJAG00000007263 transcript:ENSCJAT00000014268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHHLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVHASNEVWPHST
ERTKEETGAARANGDVLPTAGREAPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGQS
GVPGEDAGPHLSSPRMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences B0KWB4
XP_008982576.1.60252 XP_008982577.1.60252 ENSCJAP00000013546 ENSCJAP00000013546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]