SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013687 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013687
Domain Number 1 Region: 186-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.75e-54
Family Voltage-gated potassium channels 0.00078
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily POZ domain 6.08e-33
Family Tetramerization domain of potassium channels 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013687   Gene: ENSCJAG00000007354   Transcript: ENSCJAT00000014417
Sequence length 491
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:90670144:90685799:-1 gene:ENSCJAG00000007354 transcript:ENSCJAT00000014417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFGEFFRRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLVGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCTEDAPEKCHELPYFNIRDIYAQQMHAFITSFSSVGIVVSDPDSTDASSIEDNEDIC
NTISLENCTAK
Download sequence
Identical sequences F7AEV5
XP_002758060.1.60252 ENSCJAP00000013687 ENSCJAP00000013687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]