SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014011 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014011
Domain Number 1 Region: 125-296,343-414
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.55e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1206-1452
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.31e-35
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 523-756
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 885-1040,1080-1158
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-31
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014011
Domain Number - Region: 1457-1604
Classification Level Classification E-value
Superfamily EF-hand 0.0102
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014011   Gene: ENSCJAG00000007392   Transcript: ENSCJAT00000014758
Sequence length 2138
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:29289898:29622646:1 gene:ENSCJAG00000007392 transcript:ENSCJAT00000014758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEAETRGCCRSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTI
SSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIT
ETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGG
PSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARK
ESLENKKNNKPEVNQVANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVP
AGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSS
AALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDM
LVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMI
VTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNS
DFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNHRVEISIFFIIYIIIVA
FFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWY
VVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFK
PKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEG
IRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMKDNNQINRNNNFQTFPQA
VLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLI
INLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPP
LGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRA
VIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKN
TTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEEAKREEEDDVFKRNGALLGNHVNHVNS
DRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTN
ANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRSDSGDEQLPTIC
REDPEVHGYFRDPRCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNMDFERPRGY
HQPQGFLEDDDSPICYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEIPSSPTFF
PHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQV
EQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTIPSSFRNKNSDKQRSADSLVE
AVLISEGLGRYARDPKFVSATKYEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLS
HQQDYELQDFGPGYSDEEPDLGRDEEDLADEMICITTL
Download sequence
Identical sequences F7I2L9
XP_002758480.1.60252 ENSCJAP00000014011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]