SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014013 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014013
Domain Number 1 Region: 385-420,458-571
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-27
Family Phosphate binding protein-like 0.00028
Further Details:      
 
Domain Number 2 Region: 269-374
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000173
Family L-arabinose binding protein-like 0.0086
Further Details:      
 
Domain Number 3 Region: 748-792
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000119
Family Phosphate binding protein-like 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014013
Domain Number - Region: 554-652
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00216
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014013   Gene: ENSCJAG00000007539   Transcript: ENSCJAT00000014760
Sequence length 921
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:713204:726373:1 gene:ENSCJAG00000007539 transcript:ENSCJAT00000014760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVRAPWLGLALALALGSAGGHPQPCGVLARLGGSVRLGALLAPQLPHNLSLELVFLAP
RARNSVSLLARSLCQALAAPGVAVLLAFPEARPELLQLHFLAAATETPVLIVLRREARAA
PLGAQNPFHLQLHWASPLETLLDVLVAVLEAHAWEDVGLALCHTRDPGALVALWTSRAGR
APQLVLDLSRQDTGDAGLRARLAPMGAPMGGEAPVSAAVLLGCDVARARRVLEAVPPGPH
WLLGTPLPPKALPTAGLPPGLLALGEVAQPPLEAAIHDAVQLVARALGSAAQVQPERALL
PAAVNCGDPQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSSQVHVSRHFKVCSLRRDP
QGAPAWATVGRWQDGRLHLEPRGAVARPPPPPGTQARPKLRVVTLVEHPFVFARDPDEDG
QCPAGQLCLDPGTNDSATLDALFAALANGSVPRALRKCCYGYCIDLLERLAEDTPFDFQL
YIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMV
RARDTASPIGAFMWPLHWSMWLGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYS
SALNLCYAILFGRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFLQL
SGIHDPKAGLPGEGVVSWAWRTSARPTLVPRDIDFHQVPLTRRHDGIVRNRGLEGLGGDG
SKNGVRLSPDVSGDTVNYEAQSQKTNGVPAPPGYGIGLPQNSPLTSNLSEFISRYKSSGF
IDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFSGLFVLLCLGLGSALLSSLGEHAFYRLA
LPRIRRGSRLQYWLHTSQKIHRALITEPLQGSKEETAEAETRAGSVPQLASKVDQHSMNL
AGRLPEGWKRARLAVYQERRL
Download sequence
Identical sequences F7I2L7
ENSCJAP00000014013 ENSCJAP00000014013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]