SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014021 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014021
Domain Number 1 Region: 125-296,343-414
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-38
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1226-1487
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-35
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 543-776
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 905-1060,1100-1178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.75e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014021
Domain Number - Region: 1492-1639
Classification Level Classification E-value
Superfamily EF-hand 0.0109
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014021   Gene: ENSCJAG00000007392   Transcript: ENSCJAT00000014768
Sequence length 2182
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:29289898:29622646:1 gene:ENSCJAG00000007392 transcript:ENSCJAT00000014768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEAETRGCCRSLWCWWRRRGATKAGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQVANSDNKVTIDDYREEDEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCH
KLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
VYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESETVPVP
TATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQMFGKVAMKDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKL
CDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPH
HLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS
DGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDE
VTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISC
DLQDDEPEEAKREEEDDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPP
ASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHV
SENGHHSSHKHDREPQRRSSVKRTRYYETYIRSDSGDEQLPTICREDPEVHGYFRDPRCL
GEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNMDFERPRGYHQPQGFLEDDDSPICY
DSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEIPSSPTFFPHRTALPLHLMQQQIM
AVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSL
HRSSWYTDEPDISYRTFTPASLTIPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPK
FVSATKYEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHQQDYELQDFGPGYSD
EEPDLGRDEEDLADEMICITTL
Download sequence
Identical sequences F7I2J8
ENSCJAP00000014011 ENSCJAP00000014021 XP_002758478.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]