SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014024 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014024
Domain Number 1 Region: 307-480,509-570
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.59e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 574-759
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.25e-44
Family cAMP-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014024   Gene: ENSCJAG00000020150   Transcript: ENSCJAT00000014771
Sequence length 1064
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:95862108:95879954:1 gene:ENSCJAG00000020150 transcript:ENSCJAT00000014771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHSAGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLA
PGRAKTFRLKLPALLALTARESSVRSGRAGGTGAPGAVVVDVDLAPAAPSSESLALDEMT
AMDNHVAGLGPAEERRVLVGRGSPPAPAPGPLPSPPRAHSLNPDASGSSCSLARTRSRES
CASVRRASSADDIEAMRAGALPPPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQ
ITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRI
HRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPAAPDCGYACQPLAVV
DLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGS
GSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNME
QPHVDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTN
SEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQ
RLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALA
MKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARP
GKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSA
ELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGDSPSSGP
SSPESSEDEGPGRSSSPLRLVPFSSPRPPGELPGGEPLTEDCEKSSDTCNPLSGAFSGVS
NIFSFWGDSRGRQYQELPRCPAPTPSLLNIPLSSPGRRPRSDVESRLDALQRQLNRLETR
LSADMASVLQLLQRQMTLVPPAYSAVTTPGPGPTSTFPMLPVSPLPPLTLDSLSQVSQFM
ACEELPPGDPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences F7I2J5
ENSCJAP00000014024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]