SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014208 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014208
Domain Number 1 Region: 7-436
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-132
Family ALDH-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014208   Gene: ENSCJAG00000007652   Transcript: ENSCJAT00000014972
Sequence length 437
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:135402719:135437659:-1 gene:ENSCJAG00000007652 transcript:ENSCJAT00000014972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
ILHHISECTQMDHLGCMHYTVRTPVGVGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFT
GSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECVPATVRSSFANQGEICLCT
SRIFVQKSIYREFLKRFVEATREWKVGIPSDPLASMGALISKAHLEKVRSYVKKALAEGA
QIQCGEGVDKLSLPARNQAGYFMLPTVITDIRDESCCMTEEIFGPVTCVVPFDSEEEVIE
RANSLKYGLAAVVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGA
KDSYDFFTEIKTITIKH
Download sequence
Identical sequences F7HXP8
ENSCJAP00000014208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]