SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014378 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014378
Domain Number 1 Region: 61-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.73e-66
Family Ankyrin repeat 0.0000251
Further Details:      
 
Domain Number 2 Region: 403-591
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.54e-43
Family Ankyrin repeat 0.0000946
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014378
Domain Number - Region: 763-906
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0518
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014378   Gene: ENSCJAG00000007735   Transcript: ENSCJAT00000015150
Sequence length 1115
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:24321705:24377907:-1 gene:ENSCJAG00000007735 transcript:ENSCJAT00000015150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKMWRPGEKKEPQAVLYEDVPNDTDDCKESLKVVFEGSTCGLQNFKNQKILNRCNNVDI
SLHYAAAKGQVELMEKITRDSSFEVLNAMDDYGNTPLHCAVEENQIESVKFLLSRGANPN
LRNFNMIAPLHIAVQGTHNEVMKVLLEHRSIDINLEGENGNTSVIIACTKNNSEALQILL
NKGAKPCKSNKWGCFPIHQAAFSGSKECMEILLRFGEEHGYNRQLQINFVNNGKASPLHL
AVQNGDLEMIKMCLDNGAQIDLVEKGRCTALHFAATQGATEIVKLMISSYSGGMDIVNTT
NGSGETMLHRASLFDHHELADYLISVGADINSIDSEGRSPLILATASASWNVVNLLLSKG
AQVNIKDNFGRNFLHLTVQHPYGLKNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGG
PGSVNNLLGFNVSINSKSKDKKSPLHFAASYGRINTCQRLLQDITDTRLLNEGDLHGMTP
LHLAAKNGHEKVVQLLLKKGALFLSDHNGWTALHHASVGGYTQTMKVILDTNLKCTDRLD
EDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHVALHNKRKEVVLTTIRSKRW
DECLKVFCHNSPGNKCPITEMIEYLPECMKVLLDFCMLPSTEDKSCRDYYIEYNFKYLQC
PLEFTRKTTPTQDITYEPLIALNAMVQNNRIELLNHPVCKEYLLMKWMAYGFRAHMINLG
SYCLGLIPMTFLVVNIKPGMAFNSTGIINETSDHSEILDTTDSYLIKTCMILVFLSSIFG
YCKEVVQIFQQKRNYFMDINNIIEWIIYTTGIIFVLPLFIEIPAHVQWQCGAVAIYLYWM
NFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFVFLLLAFGLSFYVLLNLQDAYSSPLLS
IIQTFSMMLGDINYRESFLEPYLRNELAYPVLSFAQLIFFTLFVPIVLMNLLIGLAVGDI
AEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGILFHIFFCLF
CTGEIRQEIPNADTSLEMEILKQKYRLKDLTCLLEKQHELIKLIIQKMEIISETEDEDNH
CSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEH
Download sequence
Identical sequences F7I9G3
ENSCJAP00000014378 ENSCJAP00000014378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]