SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014429 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014429
Domain Number 1 Region: 105-211
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 2 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 9.42e-21
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 3 Region: 214-270
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-16
Family Kringle modules 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014429   Gene: ENSCJAG00000007769   Transcript: ENSCJAT00000015207
Sequence length 292
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:40260380:40293144:-1 gene:ENSCJAG00000007769 transcript:ENSCJAT00000015207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVKTGLCCVLLLCGAVFAWPSQEIHARFRRGARSYRVLCRDEKTQMIYQQHESWLRPV
IRSNRVEYCWCNSGRAQCHSVPIKSCSEPRCFNGGTCRQALYFSDFVCQCPEGFTGKRCE
IDTKATCYEDEGISYRGTWSTAESGAECTNWNSSVLAQKPYSGRRPDAVRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSKGENGDCYFGKGLTYRGTHSLTTSGASCLPW
NSMILIDKVYTAHNPNAQALGLGKHNFCRTGRSVSCLAMESMRPLLLSIRSG
Download sequence
Identical sequences F7HZZ4
ENSCJAP00000014429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]