SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014458 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014458
Domain Number 1 Region: 236-499
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.14e-87
Family Eukaryotic proteases 0.000000000803
Further Details:      
 
Domain Number 2 Region: 151-239
Classification Level Classification E-value
Superfamily Kringle-like 2.15e-31
Family Kringle modules 0.0000118
Further Details:      
 
Domain Number 3 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 4.29e-20
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 4 Region: 83-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000023
Family EGF-type module 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014458
Domain Number - Region: 122-148
Classification Level Classification E-value
Superfamily Kringle-like 0.000885
Family Kringle modules 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014458   Gene: ENSCJAG00000007769   Transcript: ENSCJAT00000015240
Sequence length 500
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:40260702:40293134:-1 gene:ENSCJAG00000007769 transcript:ENSCJAT00000015240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVKTGLCCVLLLCGAVFAWPSQEIHARFRRGARSYRVLCRDEKTQMIYQQHESWLRPV
IRSNRVEYCWCNSGRAQCHSVPIKSCSEPRCFNGGTCRQALYFSDFVCQCPEGFTGKRCE
IDSKPWCYVFKAGKYSSEFCSTPACSKGENGDCYFGKGLTYRGTHSLTTSGASCLPWNSM
ILIDKVYTAHNPNAQALGLGKHNFCRNPDGDAKPWCHVLKNLRLTWEYCDIPSCSTCGLR
QYNQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQER
FPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSHCAQE
SNVVRTVCLPVADLQLPDWTECELSGYGKHEATSPFYSERLKEAHVRLYPSSRCTSQHLF
NRTVTNNMLCAGDTRSGGPQANLHDACQGDSGGPLVCSKDGRMTLVGIISWGLGCGQKDV
PGVYTKVTNYLDWIQDNMRP
Download sequence
Identical sequences F7HV90
ENSCJAP00000014458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]