SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014639 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014639
Domain Number 1 Region: 22-79
Classification Level Classification E-value
Superfamily dUTPase-like 0.00000000068
Family dUTPase-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014639   Gene: ENSCJAG00000007902   Transcript: ENSCJAT00000015439
Sequence length 144
Comment pep:novel chromosome:C_jacchus3.2.1:1:127976495:127990098:1 gene:ENSCJAG00000007902 transcript:ENSCJAT00000015439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVIPAYWEAEAGRSLEPGFTDTTIIPLNWMLRPPPGHLRLLLPLSQQAKNRVTELLAVV
TDPDYQGEISLLFHNESHLKEEKMEGACLGLPGRGESLEHQVQRHKTIVGYSQTTISRKD
AGKAIICRKLTQEQKTKHRMFSFT
Download sequence
Identical sequences F7I258
ENSCJAP00000014639 ENSCJAP00000014639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]