SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014652 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014652
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-161
Family ALDH-like 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014652   Gene: ENSCJAG00000007652   Transcript: ENSCJAT00000015455
Sequence length 487
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:135401922:135437681:-1 gene:ENSCJAG00000007652 transcript:ENSCJAT00000015455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
ILHHISECTQMDHLGCMHYTVRTPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCRLLDEAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECVPATVRSSFANQGEICLCTSRIFVQKSIY
REFLKRFVEATREWKVGIPSDPLASMGALISKAHLEKVRSYVKKALAEGAQIQCGEGVDK
LSLPARNQAGYFMLPTVITDIRDESCCMTEEIFGPVTCVVPFDSEEEVIERANSLKYGLA
AVVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITIKH
Download sequence
Identical sequences F7HZS8
XP_002747097.1.60252 ENSCJAP00000014208 ENSCJAP00000014652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]