SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014824 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014824
Domain Number 1 Region: 37-153,201-286
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.64e-20
Family DNA gyrase/MutL, N-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014824
Domain Number - Region: 767-819
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0929
Family RILP dimerisation region 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014824   Gene: ENSCJAG00000007983   Transcript: ENSCJAT00000015640
Sequence length 902
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:95591365:95642308:-1 gene:ENSCJAG00000007983 transcript:ENSCJAT00000015640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARASPGPPGQGSGGSRQAFGIRLSTMSPRYLQSNSCSHTRPFSAIAELLDNAVDPDVSAR
TVFIDVEEVKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPIGVFGNGFKSGS
MRLGKDALVFTKNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNKKMIITEDSLPSLE
AILNYSIFNSENDLLAQFDAIPGKKGTRVLIWNIRRNKDGKSELDFDTDQYDILVSDFHT
EEKVTGDVTSELPETEYSLRAFCGILYMKPRMKIFLRQKKVTTQMIAKSLANVEYDTYKP
AFTNKQVRITFGFSCKNSNQFGIMMYHNNRLIKSFEKVGCQVKPTRGEGVGVIGVIECNF
LKPAYNKQDFEYTKEYRLTINALAQKLNAYWKEKSSQDNFETSAVVRPVPKVPDQTWVQC
DECLKWRKLPGKIDPSMLPARWFCYYNSHPKYRRCSVPEEQELNDEDLYLSKAKKQDTEQ
TVEKKKMPVENENHQVCSNPPKNLTVQEMAGLNNKTTGYEGIHSPSVLPSGGEESRSPSL
QLKPLDSSVLQYSSKYKWIVGEEPVEKRRRLQNEMTAPVLDYSMPAPYRRVEAAVAYPEG
ENNHDKSSSERSTPPYLFPEYPEASKNTGQNREISILNPGAQDQRQGSLLPEELEDQMPR
LVAEESNRGSTSINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAIESW
NPAPYSVASAAIPAAAIGDKGRGYEENEGCNTPKMKNQRELEELKRTTEKLERVLAERNL
FQQKVEELEQERNHWSEFKKVQHELVFPTQDAEGLYWSKKIQEITDETETHLEMLQKAQS
PTGPQREDDLERALAKLTRLRIHVSYLLTSVLPHLELREIGYDSEQVDGILYTVLEANHI
LD
Download sequence
Identical sequences F7IBE1
ENSCJAP00000014824 ENSCJAP00000014813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]