SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015533 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015533
Domain Number 1 Region: 354-545
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.19e-50
Family cAMP-binding domain 0.0000000291
Further Details:      
 
Domain Number 2 Region: 87-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-36
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015533   Gene: ENSCJAG00000008422   Transcript: ENSCJAT00000016410
Sequence length 774
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:9305883:9317023:1 gene:ENSCJAG00000008422 transcript:ENSCJAT00000016410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANARPRPLPGSSEGATPGLEAVPPAAPPPATATSGPIPGSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPEAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFEEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
QDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLRRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGLAPSTGARLSGKP
VLWEPLVHVPLQAAAVTSNVAIALTHQRGPLPLSPDSPAILLARSARRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPGGPQLSANM
Download sequence
Identical sequences F7ELT3
ENSCJAP00000015533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]