SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015632 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015632
Domain Number 1 Region: 150-312
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-27
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000015632
Domain Number - Region: 327-446
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000551
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015632   Gene: ENSCJAG00000010526   Transcript: ENSCJAT00000016518
Sequence length 494
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:179867666:179887746:1 gene:ENSCJAG00000010526 transcript:ENSCJAT00000016518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLEDPALGIG
CWGCPKQNYTFNDSTSEINWAPILWVERKMTLWVIQVSSPPCSPPHCSGSVSTGNKGNIW
EQIFRVSFVLEMINTLPFIITIFWPPLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQ
SAMFNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKI
WPSQLLVVIMICVALVVLPLQFEELVYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKID
LLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMR
AKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFAD
HVVCEEECKYAMLALNCICPATSTLITLLVHTSRGQEGQESPEQWQRMYGRCSGNEVYHI
RMGDSKFFREYEGK
Download sequence
Identical sequences F7H4J2
ENSCJAP00000015632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]