SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015763 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015763
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-40
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 2 Region: 931-1083
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-40
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 3 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-38
Family C-type lectin domain 0.000000164
Further Details:      
 
Domain Number 4 Region: 789-925
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-38
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 5 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-35
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.43e-34
Family Cysteine rich domain 0.00000093
Further Details:      
 
Domain Number 7 Region: 499-638
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-31
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 8 Region: 229-345
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-30
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 9 Region: 1091-1215
Classification Level Classification E-value
Superfamily C-type lectin-like 5.64e-29
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-20
Family Fibronectin type II module 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015763   Gene: ENSCJAG00000008479   Transcript: ENSCJAT00000016655
Sequence length 1454
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:15622095:15728475:1 gene:ENSCJAG00000008479 transcript:ENSCJAT00000016655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFASVIPGAVQLLDTRQFLIYNEDHRRCVEAINPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVPVTLYACDAKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEAMYTLRGNANGATCAFPFKFGNKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLYGYCPLKFEGSESLWNKDPLTSISYQINSQSALTW
HQARKSCQQQSAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPT
NCPSQWWPYAGYCYKIHREEKKIQRDALTACRKEGGDLASIHTIEEFDFIISQLGYEPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRACEW
PLGYICKMRSRSQGPEIVEVETGCKKGWKRHHFYCYLIGHTLSTFAEANQTCNNEKAYLT
TVEDRYEQAFLTSFIGLRPEKYFWTGLSDIQTKGTFQWTIEEEVQFTHWNSDMPGRKPGC
VAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTRPPEPTTTPEPRCPEDWGTSSRTSLCF
KLFAKGKHEKKTWFESRDFCRALGGDLASISSKEEQQTIWRLITASGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAFGEPNNYQNVEYCGELKGEPGMTWNDINCEHLNNWICQIH
RGQTPKPEPTPAPQDNPPVTEDGWVIYKDHQYYFSKEKETMDNARAFCKRNFGDLVSIQS
ESEKKFLWKYVNRNDAQSTYFIGLLISLDKTFAWMDGSKVDYVSWATGEPNFANEDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATVTPTIPSVPSGCKEDWNFYNNKCFKIFG
FVKEERKNWQEARKACIGFGGNLASIQNEKEQAFLTYHMKDSTFSAWTGLNDVNSEHMFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDVDCVVIIGGPSNEAGKWMDDNCDKKRGYICQI
PPDPSLTNPPATTSTDGFIKYGKSSYSIMRQKLQWHEAETYCRHHNSLLASILDPYSHAF
AWLQMEKSDERVWIALNSNLTDNKYTWIDKWRVRYTNWAADEPKLKSACVYLDLDSYWKT
AHCNESFYFLCKKSDEVPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASL
DCLRMGSSLASIESAAEASFLSYRVEPLKSKTDFWIGMFRNIQGTWLWINNSPVSFVNWN
TGDPSNERNDCVVLQASSGFWSNAHCSSYKGFICKRPKIIDARPTHELLSTKADPRKIDP
SKPSSNVAGVVIVILLVLMGAGLAAYFFYKKRRVQLPQEGAFENTLYFNSQSSPGTSDMK
DLVGNIEQNEHALI
Download sequence
Identical sequences F7DSZ1
ENSCJAP00000015763 XP_008998246.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]