SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015845 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015845
Domain Number 1 Region: 113-174
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.06e-25
Family Transcriptional factor domain 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015845   Gene: ENSCJAG00000008605   Transcript: ENSCJAT00000016740
Sequence length 439
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:76261493:76301212:-1 gene:ENSCJAG00000008605 transcript:ENSCJAT00000016740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNPCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERD
STNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAVAASLAGGHHREAWT
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYSSEDMKEGGI
DMDAFQEREEGRAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTTANGSDSESETSE
SDDDSPPRPATVAAHQREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP
EEKEAYIAMGQRMFEDLFE
Download sequence
Identical sequences F7GNV1
ENSCJAP00000015845 ENSCJAP00000015845 XP_002758809.1.60252 XP_017820692.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]