SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015879 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015879
Domain Number 1 Region: 10-122
Classification Level Classification E-value
Superfamily POZ domain 7.69e-19
Family BTB/POZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015879   Gene: ENSCJAG00000008629   Transcript: ENSCJAT00000016777
Sequence length 712
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:113587465:113594539:-1 gene:ENSCJAG00000008629 transcript:ENSCJAT00000016777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSPASPKILYRNPRFLRLAFLQLHNQQQSGVFCDVLLQAEGEAVPAHCCILSACSPFFT
ERLKRERPTQNQKVVLELGGLKIRTLRKLVDFLYTSKMEVSQEEAQDVLSAARQLRVSEL
ESLQLEGGKLVKAPQGRRLNRECLQPTSVAPISARVVTPSHHSQTALPATQTLCPLGAVR
LKSLGKEEEPQENNRQNSDNLSGTIFKRKAKACPAPQEASSSPSSHSQGPRESKNDTALN
PTVLSPPSLYPSVDRHLLPRKIRLSRSKPLPDICTSKPSSILSGSSAVPATPGRRLWRQR
SVSKEAPENKPKAGRASPLKSIPSPSSLGKTGGSKKRSPDVRAPNSESAEEGQVGRVKLR
KIVNGTCWEVVQEPPLKNSQDSPQIPDPGGVFKEPSGTQQSSGNEQEMSSTRTELCQDSP
VCSKIQDILVSASESPDHPVVKSEFGSSPELVKKDPMLAIDCREPYAFDTGLLEQPCEAE
EYRITSAAATSELEDILDFMLCGSNIEPPGGSLESPRAEGCRTPTYHLTETGKNWIEGEE
WCLPDMDLWSRELTELEKEPTGENKEPTELLSSLVMPSEVSGEVLSVGSPWTPDLEITSS
PPLDGQEDKLNHVSSLDPPQRSNGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSS
HYKLLGSLPASSEEEEIDVVDWTAEGKLVPTSVPSVWPDPSSESETEVDILT
Download sequence
Identical sequences F7G473
ENSCJAP00000015879 XP_017833632.1.60252 ENSCJAP00000015879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]